top of page

CircRNA

Gene

chr4|67505204|67519502|-|7|circRNA|CENPC|ENST00000273853.10|12,11,10,9,8,7,6

CENPC

CircRNA UID

circCENPC(12,11,10,9,8,7,6)

Open Reading Frame (ORF)

LERMMWMMRKFMEVQFRPMKFIRKFWQLMLVPKIHLTRKKYQVET

Peptide

KFWQLMLVPK

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page