top of page

CircRNA

Gene

chr4|55442431|55510065|—|21|circRNA|CLOCK|NM_001267843|22,21,20,19,18,17,16,15,14,13,12,11,10,9,8,7,6,5,4,3,2

CLOCK

Open Reading Frame (ORF)

LSGHSQQTSLPSQTQSTLTAPLYNTMVISQPAAGSMVQIPSSMPQNSTQSAAVTTFTQDRQIRIFTCSCKAAGAQKLILSHCKMPLDNSTVLLNESLELGKSH

Peptide

LILSHCKMPLDNSTVLLNESLELGK

ORF Found in Long-Read

false

Peptide Length

25

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

25

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page