top of page

CircRNA

Gene

chr4|54695511|54737280|+|19|circRNA|KIT|ENST00000412167.6|2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20

KIT

CircRNA UID

circKIT(2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20)

Open Reading Frame (ORF)

LIRALSNGLLRSWMKRMRISRMNGSRKRQKPPTPANTRAPTNTA

Peptide

ALSNGLLR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page