top of page

CircRNA

Gene

chr4|47665031|47807047|—|10|circRNA|CORIN|ENST00000273857.8|11,10,9,8,7,6,5,4,3,2

CORIN

Open Reading Frame (ORF)

LATGLKRKHPSAGSLLFSLHLFKPTVINTSCSFLAPFWYQNVM

Peptide

LATGLKR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page