top of page

CircRNA

Gene

chr4|40890363|40934699|-|4|circRNA|APBB2|ENST00000295974.12|12,11,10,9

APBB2

Open Reading Frame (ORF)

MYLILENDMLSLVDPMDRSVLHSQPIVSIRVWGVGRDNGRICMQPLLTRTPV

Peptide

DNGRICMQPLLTR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page