top of page

CircRNA

Gene

chr4|40106899|40118024|+|4|circRNA|N4BP2|ENST00000261435.10|5,6,7,8

N4BP2

Open Reading Frame (ORF)

LNVLSCVHILVRIEALGLCKRIIQVESFLVLMIIFI

Peptide

IEALGLCK

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page