top of page

CircRNA

Gene

chr4|39300020|39303151|—|6|circRNA|RFC1|NM_001204747|21,20,19,18,17,16

RFC1

Open Reading Frame (ORF)

MKKHLMLLSRAADSICDGDLVDSQIRSKQNWSLLPAQMEQPLQ

Peptide

QNWSLLPAQMEQPLQ

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TAA

Peptide Type

Junction

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page