top of page

CircRNA

Gene

chr4|36107564|36124967|—|6|circRNA|ARAP2|NM_015230|27,26,25,24,23,22

ARAP2

Open Reading Frame (ORF)

LTQLNTAVIRKMTRKELKNMEHLYVLFQGSTEQH

Peptide

ELKNMEHLYVLFQGSTEQH

ORF Found in Long-Read

false

Peptide Length

19

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

19

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page