top of page

CircRNA

Gene

chr4|3414071|3422570|+|7|circRNA|RGS12|NM_002926|5,6,7,8,9,10,11

RGS12

Open Reading Frame (ORF)

LQDFGTREGQGHQALLHSSPGWDILRGGCQGGLLHQRHPVRTL

Peptide

EGQGHQALLHSSPGWDILR

ORF Found in Long-Read

false

Peptide Length

19

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

19

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page