top of page

CircRNA

Gene

chr4|3086938|3122936|+|9|circRNA|HTT|NM_002111|2,3,4,5,6,7,8,9,10

HTT

CircRNA UID

circHTT(2,3,4,5,6,7,8,9,10)

Open Reading Frame (ORF)

LEGVPHAALSFQENKKKERTFSYQERPCESLSDNM

Peptide

LEGVPHAALSFQENKK

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page