top of page

CircRNA

Gene

chr4|2630934|2660054|+|6|circRNA|FAM193A|ENST00000545951.5|3,4,5,6,7,8

FAM193A

Open Reading Frame (ORF)

MTAVSHTSSRVVSWTPPSLMTSTFTSSHFKWILLLTILLRGARPVCHLQARGPAPALPSQFSSTPGSSSQTVARHQLCSARGTPTSCTSVWNSKLESMCWR

Peptide

GPAPALPSQFSSTPGSSSQTVARHQLCSAR

ORF Found in Long-Read

false

Peptide Length

30

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

27

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page