top of page

CircRNA

Gene

chr4|25818137|25822128|-|3|circRNA|SEL1L3|ENST00000399878.7|9,8,7

SEL1L3

CircRNA UID

circSEL1L3(9,8,7)

Open Reading Frame (ORF)

LDLQRRYGRPSMCRAFPWEKELKDKHPSLFQALLEMDLLTASGRISIIMTQLGTSLLEGAGMWLALKGFLDP

Peptide

DKHPSLFQALLEMDLLTASGR

ORF Found in Long-Read

false

Peptide Length

21

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page