top of page

CircRNA

Gene

chr4|25782241|25790574|—|4|circRNA|SEL1L3|ENST00000399878.7|15,14,13,12

SEL1L3

Open Reading Frame (ORF)

MVLPQIQEKLRQSSKVLVKSRRNGEPRCVIQSWSPAFGWHLPWSSWKESSIC

Peptide

CVIQSWSPAFGWHLPWSSWKESSIC

ORF Found in Long-Read

false

Peptide Length

25

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

23

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page