top of page

CircRNA

Gene

chr4|25757533|25819940|-|16|circRNA|SEL1L3|ENST00000399878.7|23,22,21,20,19,18,17,16,15,14,13,12,11,10,9,8

SEL1L3

Open Reading Frame (ORF)

LDCAVFPVCLRFLIPSLRSNLLNKSSYIMKGVLRFKK

Peptide

FLIPSLR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page