top of page

CircRNA

Gene

chr4|24819858|24838272|-|7|circRNA|CCDC149|ENST00000504487.5|11,10,9,8,7,6,5

CCDC149

CircRNA UID

circCCDC149(11,10,9,8,7,6,5)

Open Reading Frame (ORF)

LFSDPTLPSGQRSRSPLLKFVEQPTENKADPKDALEDDDCQTKARRRSNRRATLCSP

Peptide

DALEDDDCQTKAR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

6

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page