top of page

CircRNA

Gene

chr4|1974862|1976679|+|3|circRNA|WHSC1|NM_001042424|19,20,21

WHSC1

CircRNA UID

circWHSC1(19,20,21)

Open Reading Frame (ORF)

LVLCDRKFCTKAYHLSCLGLGKRPFGPYNRRWPQRKLLSIYESQLPAQL

Peptide

LLSIYESQLPAQL

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page