top of page

CircRNA

Gene

chr4|182600923|182628889|+|2|circRNA|TENM3|ENST00000511685.5|4,5

TENM3

CircRNA UID

circTENM3(4,5)

Open Reading Frame (ORF)

LEMHCTVCRRGLGAPGNTPVLFYRATCKQSRPVYPAALAAFP

Peptide

GLGAPGNTPVLFYRATCK

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page