top of page

CircRNA

Gene

chr4|1814604|1815663|—|1|ciRNA|LETM1|ENST00000302787.2|13

LETM1

Open Reading Frame (ORF)

LREKTHLVATHVPGPRPQLVALGSRGGAANTSQGPPTLRGDCTGSLGALHTCRGPPKLRGNYTGEPRGSLGTAPRLRGDCWAELPSAATQVPG

Peptide

GSLGTAPR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page