top of page

CircRNA

Gene

chr4|169555931|169590809|—|12|circRNA|NEK1|NM_001199397|17,16,15,14,13,12,11,10,9,8,7,6

NEK1

Open Reading Frame (ORF)

LGSGGTIAPSSFSSRGQYEHYHAIFDQMQQQRAEDNEAKWKREIYGRGLPERFWTGLYRYVWP

Peptide

GLPERFWTGLYR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page