top of page

CircRNA

Gene

chr4|169555931|169561554|—|2|circRNA|NEK1|NM_001199397|17,16

NEK1

Open Reading Frame (ORF)

MNITMPFLTKCSNKEQKIMKLNGKEKYMVEVFQKVGKNK

Peptide

MNITMPFLTK

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page