top of page

CircRNA

Gene

chr4|1654977|1668905|—|3|circRNA|FAM53A|NM_001013622|4,3,2

FAM53A

Open Reading Frame (ORF)

LISPSCRACLLPLTPWVFSGSHSPRAQAQAWVQPAPWTPVKAQARPRPHRPSGIAGPCQNPRSLCAAGPPGAPAAPRSGLQSPRGGATAAGVPRGREAPAPSCRGVLCGRPVPPRPPRPGRPPPAAASWTAARAVRAQARSGVPRSPACPPRGAARPSHRSDSRVRALPCPGPAAAPRPRLRWAGAVGCSGAAHSLACSVGRGAGANGGVRRTPGGHAHPWTS

Peptide

GAGANGGVR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page