top of page

CircRNA

Gene

chr4|16179657|16186534|-|1|ciRNA|TAPT1|NM_153365|7

TAPT1

Open Reading Frame (ORF)

LCTIYQIGNSLGFYTRILLPKVFHFTLCFYFFFRKMETVVICPQSPLEEPNDLI

Peptide

METVVICPQSPLEEPNDLI

ORF Found in Long-Read

false

Peptide Length

19

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

19

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page