top of page

CircRNA

Gene

chr4|159304341|159356158|+|22|circRNA|RAPGEF2|ENST00000264431.8|2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23

RAPGEF2

CircRNA UID

circRAPGEF2(2,3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19,20,21,22,23)

Open Reading Frame (ORF)

LEFPLLTFQKGTPIQPGNRRTTTWPFRDRGWSHDPPTQLGLHPYSSHMGIPPAAGL

Peptide

GTPIQPGNRR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page