top of page

CircRNA

Gene

chr4|151143909|151175674|-|6|circRNA|SH3D19|ENST00000409598.8|12,11,10,9,8,7

SH3D19

Open Reading Frame (ORF)

LNCQRNQTLALYEVLILRFREEGPWLRALIVGRKCQLLPRGLCC

Peptide

EEGPWLRALIVGR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page