top of page

CircRNA

Gene

chr4|147946616|148023413|+|5|circRNA|ARHGAP10|ENST00000336498.7|15,16,17,18,19

ARHGAP10

CircRNA UID

circARHGAP10(15,16,17,18,19)

Open Reading Frame (ORF)

LSPPACQHHPQMRHQGSRRDKAREPRGPWPSTIFVWSWKMM

Peptide

GPWPSTIFVWSWKMM

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TAA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page