top of page

CircRNA

Gene

chr4|143538589|143543972|+|5|circRNA|SMARCA5|ENST00000283131.3|12,13,14,15,16

SMARCA5

CircRNA UID

circSMARCA5(12,13,14,15,16)

Open Reading Frame (ORF)

MKSSPRWAKVHLETLQWIQSQVFITSKEKTIEKNKRFTSTNLQSNDKGIGHFGRLLHVEKL

Peptide

FTSTNLQSNDK

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page