top of page

CircRNA

Gene

chr4|139517884|139533366|-|5|circRNA|SETD7|NM_001306199|7,6,5,4,3

SETD7

Open Reading Frame (ORF)

LTAGTGPLMGTPSPLMKKRSLMCLSPITTYPSTVPPWDTRQITPSLQTASTISPWRGIMWMMPCRAREFTLTKMGEFSRARM

Peptide

GIMWMMPCRAR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page