top of page

CircRNA

Gene

chr4|139060323|139062057|-|2|circRNA|ELF2|ENST00000394235.6|9,8

ELF2

CircRNA UID

circELF2(9,8)

Open Reading Frame (ORF)

MPKNIVVIDDDKSETCNEDLAGTTDEKSLERVSLSAESLLKAASSVRSGKNSSPINCSRAEKGVARVVNITSPGHDASSRSPTTTASVSATAAPRKHNLFVGVSFRSTSR

Peptide

HNLFVGVSFR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

riboCIRC,TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page