top of page

CircRNA

Gene

chr4|128936654|128965318|—|8|circRNA|SCLT1|ENST00000281142.9|18,17,16,15,14,13,12,11

SCLT1

Open Reading Frame (ORF)

MEHEFSIKERGFEVQLREMEDSNRNSIVELRHLLATQQKAANRWKEETKKLTESAEIRINNLKRRMWCLPMEERKHQIGVYSSYSLV

Peptide

HQIGVYSSYSLV

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page