top of page

CircRNA

Gene

chr4|128888678|128946152|-|5|circRNA|SCLT1|ENST00000281142.9|20,19,18,17,16

SCLT1

CircRNA UID

circSCLT1(20,19,18,17,16)

Open Reading Frame (ORF)

LLQLPSRFTVKAEEMRVITENWKKCTKDSWFQSVQKMIFS

Peptide

VITENWKK

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page