top of page

CircRNA

Gene

chr4|128846374|128849167|+|2|circRNA|JADE1|NM_024900|4,5

JADE1

Open Reading Frame (ORF)

MFIRPKKYIVSSGSEPPELGYVDIRTLADSVCRYDLNDMDAAWLELTNEEFKEMGV

Peptide

YDLNDMDAAWLELTNEEFKEMGV

ORF Found in Long-Read

false

Peptide Length

23

Stop Codon

TAG

Peptide Type

Junction

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

22

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page