top of page

CircRNA

Gene

chr4|119261714|119272034|+|5|circRNA|USP53|NM_019050|11,12,13,14,15

USP53

Open Reading Frame (ORF)

MLIVFLVKVKKDSIVQDINQISVISLNLARIRVLVIGQKRIQSKKV

Peptide

VLVIGQK

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page