top of page

CircRNA

Gene

chr4|112644424|112644871|+|2|circRNA|LARP7|NM_001267039|3,4

LARP7

CircRNA UID

circLARP7(3,4)

Open Reading Frame (ORF)

LKRKKKLKKRNGHELNRCLQILLSKWTSGLGMQIFTRIDFFENR

Peptide

IDFFENR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page