top of page

CircRNA

Gene

chr4|108004663|108033292|+|7|circRNA|HADH|ENST00000505878.3|2,3,4,5,6,7,8

HADH

CircRNA UID

circHADH(2,3,4,5,6,7,8)

Open Reading Frame (ORF)

MKLGAGYPMGPFELLDYVGLDTTKFIVDGKRLASAAMRDNSFKKGMKREVRWKRDF

Peptide

LASAAMRDNSFK

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

TranCirc

Potential Cryptic Translation

false

bottom of page