top of page

CircRNA

Gene

chr4|102801560|102802560|—|1|ciRNA|UBE2D3|NM_001300795|5

UBE2D3

Open Reading Frame (ORF)

LIILSFALKDVCFYLNKILKSFCFSKYFPSKSVSIDLCFISKE

Peptide

SVSIDLCFISK

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page