top of page

CircRNA

Gene

chr4|10098991|10103986|—|2|circRNA|WDR1|ENST00000499869.6|4,3

WDR1

Open Reading Frame (ORF)

MSTSLSLGRSKTLLGLKTVRGSPWSGKEGRKPSPC

Peptide

MSTSLSLGR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page