top of page

CircRNA

Gene

chr3|81577924|81642990|-|6|circRNA|GBE1|NM_000158|12,11,10,9,8,7

GBE1

Open Reading Frame (ORF)

LVGDKSLAFWLMDAEMYTNMSVLTPFTPVIDRGIQLHKMIRLITHGLGGEGYLNFMAVMEHLKSYKNW

Peptide

LITHGLGGEGYLNFMAVMEHLKSYK

ORF Found in Long-Read

false

Peptide Length

25

Stop Codon

TAG

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

10

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

true

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

true

bottom of page