top of page

CircRNA

Gene

chr3|81577924|81642990|—|6|circRNA|GBE1|NM_000158|12,11,10,9,8,7

GBE1

Open Reading Frame (ORF)

LVGDKSLAFWLMDAEMYTNMSVLTPFTPVIDRGIQLHKMIRLITHGLGGEGYLNFMAVMEHLKSYKNW

Peptide

LITHGLGGEGYLNFMAVMEHLK

ORF Found in Long-Read

false

Peptide Length

22

Stop Codon

TAG

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

true

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

true

bottom of page