top of page

CircRNA

Gene

chr3|74361889|74371399|—|6|circRNA|CNTN3|ENST00000263665.6|10,9,8,7,6,5

CNTN3

Open Reading Frame (ORF)

MLGSSMNTHRLLKKIVGDLSPRRQGTSTYLRWSRLMWEITHVW

Peptide

KIVGDLSPR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page