top of page

CircRNA

Gene

chr3|73602353|73602461|-|1|circRNA|PDZRN3|NM_015009|3

PDZRN3

CircRNA UID

circPDZRN3(3)

Open Reading Frame (ORF)

LTVGLQPRKEACKFMTGLLRITTMDHPVKESLYPR

Peptide

LTVGLQPR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA,PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page