top of page

CircRNA

Gene

chr3|69029814|69033704|-|2|circRNA|TMF1|ENST00000398559.6|11,10

TMF1

CircRNA UID

circTMF1(11,10)

Open Reading Frame (ORF)

MRTIETPGSRESKPGTESKCFINNKTIASTNRKFASNPGIPDIVVGEIREESF

Peptide

FASNPGIPDIVVGEIR

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page