top of page

CircRNA

Gene

chr3|66378409|66380953|+|2|circRNA|SLC25A26|ENST00000464350.6|11,12

SLC25A26

Open Reading Frame (ORF)

LALGAGPSGSPAALVMWRMLLVTPTRLRAIWRTWLCAVSGHRLGVEGLSPGVTVHFGVAVTAYDPATVF

Peptide

LGVEGLSPGVTVHFGVAVTAYDPATVF

ORF Found in Long-Read

false

Peptide Length

27

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

27

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

true

bottom of page