top of page

CircRNA

Gene

chr3|56624478|56669791|—|19|circRNA|FAM208A|NM_001112736|23,22,21,20,19,18,17,16,15,14,13,12,11,10,9,8,7,6,5

FAM208A

Open Reading Frame (ORF)

LQLLKTSCKTLKILWAITIQSQKKTFHSLVLMRILSRSQVSIFLGMLIYYKRILWTRGQWVMLLFLK

Peptide

KTFHSLVLMR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page