top of page

CircRNA

Gene

chr3|49510418|49510819|+|1|circRNA|DAG1|ENST00000515359.6|2

DAG1

Open Reading Frame (ORF)

LPPVEISSRLCVLRDGAGVQRVRTQLWDQVTCFLT

Peptide

DGAGVQRVR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page