top of page

CircRNA

Gene

chr3|49283986|49286325|-|4|circRNA|USP4|NM_003363|19,18,17,16

USP4

CircRNA UID

circUSP4(19,18,17,16)

Open Reading Frame (ORF)

MRKKWSIRKKAKSSFQKQKAVGKMSQEMTPVRPPKRRSKASPAQKGFLPSVL

Peptide

GFLPSVL

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page