top of page

CircRNA

Gene

chr3|47909037|47918841|-|4|circRNA|MAP4|ENST00000426837.6|10,9,8,7

MAP4

CircRNA UID

circMAP4(10,9,8,7)

Open Reading Frame (ORF)

MRQLPGFLKSLKREAMKAKAKSLKIIIPHSLLEWRGRKKSLTHLLKGRMEILVVFPIKARK

Peptide

IIIPHSLLEWR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page