top of page

CircRNA

Gene

chr3|47877416|47917174|—|3|circRNA|MAP4|NM_001134364|9,8,7

MAP4

Open Reading Frame (ORF)

MTSPPHRTRSSHQAQRRKQSSLRASQGDRNGIRREATSTSIGNNDGTEDY

Peptide

SSHQAQR

ORF Found in Long-Read

true

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page