top of page

CircRNA

Gene

chr3|47678197|47693300|-|5|circRNA|SMARCC1|ENST00000254480.9|16,15,14,13,12

SMARCC1

Open Reading Frame (ORF)

LAYRNFMIDTYRLNPQEYLTSTACRRNLTGDVCAVMSEPKER

Peptide

NLTGDVCAVMSEPK

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAG

Peptide Type

Junction

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page