top of page

CircRNA

Gene

chr3|47622206|47678311|-|10|circRNA|SMARCC1|ENST00000254480.9|25,24,23,22,21,20,19,18,17,16

SMARCC1

CircRNA UID

circSMARCC1(25,24,23,22,21,20,19,18,17,16)

Open Reading Frame (ORF)

LAAVEERKIKSLVALLVETQMKKLEIKLRHFEELETIMDREKEAILGISKFYD

Peptide

EAILGISKFYD

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page