top of page

CircRNA

Gene

chr3|47422569|47423932|—|1|ciRNA|SCAP|ENST00000428413.5|9

SCAP

Open Reading Frame (ORF)

MRQCDSVGSGLTTGRGLRKNAARSSTRRVLLPCG

Peptide

MRQCDSVGSGLTTGR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page